Antibody data

Product number
H00057231-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057231-A01, RRID:AB_462381
Product name
SNX14 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00057231-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant SNX14.
Antigen sequence
QLFQEHRLVSLITLLRDAIFCENTEPRSLQDKQKG
AKQTFEEMMNYIPDLLVKCIGEETKYESIRLLFDG
LQQPVLNKQLTYVLLDIVIQELFPELNKVQKEVTS
VTSWM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.