Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002894-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002894-M01, RRID:AB_489813
- Product name
- GRID1 monoclonal antibody (M01), clone 1A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GRID1.
- Antigen sequence
LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEF
REDSSNPYVQFEILGTTYSETFGKDMRKLATWDSE
KGLNGSLQERPMGSRLQGLTLKV- Isotype
- IgG
- Antibody clone number
- 1A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Orphan glutamate receptor delta1 subunit required for high-frequency hearing.
Gao J, Maison SF, Wu X, Hirose K, Jones SM, Bayazitov I, Tian Y, Mittleman G, Matthews DB, Zakharenko SS, Liberman MC, Zuo J
Molecular and cellular biology 2007 Jun;27(12):4500-12
Molecular and cellular biology 2007 Jun;27(12):4500-12
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GRID1 monoclonal antibody (M01), clone 1A9 Western Blot analysis of GRID1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GRID1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol