Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002894-A01 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002894-A01, RRID:AB_462907
- Product name
- GRID1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant GRID1.
- Antigen sequence
- LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEF
 REDSSNPYVQFEILGTTYSETFGKDMRKLATWDSE
 KGLNGSLQERPMGSRLQGLTLKV
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references		Orphan glutamate receptor delta1 subunit required for high-frequency hearing.
				
		
	
			Gao J, Maison SF, Wu X, Hirose K, Jones SM, Bayazitov I, Tian Y, Mittleman G, Matthews DB, Zakharenko SS, Liberman MC, Zuo J
Molecular and cellular biology 2007 Jun;27(12):4500-12
		Molecular and cellular biology 2007 Jun;27(12):4500-12
				No comments: Submit comment	
	
			
			No validations: Submit validation data