Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002792-B03P - Provider product page
- Provider
- Abnova Corporation
- Product name
- GNGT1 purified MaxPab mouse polyclonal antibody (B03P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human GNGT1 protein.
- Antigen sequence
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSK
CCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGG
CVIS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of GNGT1 expression in transfected 293T cell line (H00002792-T04) by GNGT1 MaxPab polyclonal antibody.Lane 1: GNGT1 transfected lysate(8.25 KDa).Lane 2: Non-transfected lysate.