Antibody data

Product number
H00002792-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002792-M01, RRID:AB_1575234
Product name
GNGT1 monoclonal antibody (M01), clone 1F8
Provider product page
Abnova Corporation - H00002792-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant GNGT1.
Antigen sequence
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSK
CCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGG
CVIS
Isotype
IgG
Antibody clone number
1F8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -