Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00115727-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00115727-M01, RRID:AB_606918
- Product name
- RASGRP4 monoclonal antibody (M01), clone 1F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RASGRP4.
- Antigen sequence
CGLCCHKHCRDQVKVECKKRPGAKGDAGPPGAPVP
STPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQ
TESPHPSWETDTVPCPVMDPPSTASSKLDS- Isotype
- IgG
- Antibody clone number
- 1F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Galectin-3 regulates RasGRP4-mediated activation of N-Ras and H-Ras.
Shalom-Feuerstein R, Levy R, Makovski V, Raz A, Kloog Y
Biochimica et biophysica acta 2008 Jun;1783(6):985-93
Biochimica et biophysica acta 2008 Jun;1783(6):985-93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RASGRP4 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RASGRP4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol