Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB23401 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB23401, RRID:AB_11133316
- Product name
- OPN4 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant OPN4.
- Antigen sequence
PKYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTH
RSTLTSHTSNLSWISIRRRQESLGSESEV- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Ontogeny of melanophore photosensitivity in rainbow trout (Oncorhynchus mykiss).
Chen SC, Robertson RM, Hawryshyn CW
Biology open 2014 Oct 10;3(11):1032-6
Biology open 2014 Oct 10;3(11):1032-6
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human placenta with OPN4 polyclonal antibody (Cat # PAB23401) shows strong membrane positivity in trophoblastic cells at 1:10-1:20 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)