ABIN1545372

DMAC1 antibody from antibodies-online
C9orf123, MGC4730, TMEM261

Antibody data

Product number
ABIN1545372
Provider
antibodies-online
Product name
anti-Chromosome 9 Open Reading Frame 123 (C9ORF123) (C-Term) antibody
Provider product page
antibodies-online - ABIN1545372
Antibody type
Polyclonal
Antigen
The immunogen for Anti-C9orf123 antibody is: synthetic peptide directed towards the C-terminal region of Human C9orf123
Reactivity
Human
Host
Rabbit
Antigen sequence
MGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSI
ATWGI VVMADPKGKA
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.