PAB20745

DMAC1 antibody from Abnova Corporation
C9orf123, MGC4730, TMEM261

Antibody data

Product number
PAB20745
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20745, RRID:AB_10965664
Product name
C9orf123 polyclonal antibody
Provider product page
Abnova Corporation - PAB20745
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C9orf123.
Antigen sequence
MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAP
TSPAEHRLLKTCWSC
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.