HPA014585

DMAC1 antibody from Atlas Antibodies
C9orf123, MGC4730, TMEM261
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014585
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014585, RRID:AB_1845803
Product name
Anti-TMEM261
Provider product page
Atlas Antibodies - HPA014585
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAP
TSPAEHRLLKTCWSC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -