H00008862-M04

APLN antibody from Abnova Corporation
apelin, XNPEP2
No application information provided.

Antibody data

Product number
H00008862-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008862-M04, RRID:AB_1237643
Product name
APLN monoclonal antibody (M04), clone 2B6
Provider product page
Abnova Corporation - H00008862-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant APLN.
Antigen sequence
MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLE
DGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLS
HKGPMPF
Isotype
IgG
Antibody clone number
2B6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -