HPA015971

MTCH1 antibody from Sigma-Aldrich
CGI-64, PSAP, SLC25A49
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015971
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015971, RRID:AB_1854171
Product name
Anti-MTCH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015971
Antibody type
Polyclonal
Antigen
Mitochondrial carrier homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLLAHFINAYLVDDSVSDTPGGLGNDQNPGSQFSQ
ALAIRSYTK
Storage
-20C
Provider Type Product Number
- No reagents -