HPA015971

MTCH1 antibody from Atlas Antibodies
CGI-64, PSAP, SLC25A49
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015971
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015971, RRID:AB_1854171
Product name
Anti-MTCH1
Provider product page
Atlas Antibodies - HPA015971
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NLLAHFINAYLVDDSVSDTPGGLGNDQNPGSQFSQ
ALAIRSYTK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -