Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29917 - Provider product page

- Provider
- Abnova Corporation
- Product name
- MARVELD3 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial synthetic protein of human MARVELD3.
- Antigen sequence
SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVR
QLDQQYTILRSPLIY- Isotype
- IgG
- Storage
- Store at 4°C for up to one week. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Jurkat cell lysate with MARVELD3 polyclonal antibody (Cat # PAB29917).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of human lung tumor tissue lysate with MARVELD3 polyclonal antibody (Cat # PAB29917).