Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310587 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Complement Component 1, Q Subcomponent, B Chain (C1QB) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C1QB antibody: synthetic peptide directed towards the C terminal of human C1QB
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGM
EGANS IFSGFLLFPD- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Occlusal trauma accelerates attachment loss at the onset of experimental periodontitis in rats.
Gram-positive bacteria as an antigen topically applied into gingival sulcus of immunized rat accelerates periodontal destruction.
Topical application of lipopolysaccharide into gingival sulcus promotes periodontal destruction in rats immunized with lipopolysaccharide.
The formation of immune complexes is involved in the acute phase of periodontal destruction in rats.
Interaction of C1q with IgG1, C-reactive protein and pentraxin 3: mutational studies using recombinant globular head modules of human C1q A, B, and C chains.
Nakatsu S, Yoshinaga Y, Kuramoto A, Nagano F, Ichimura I, Oshino K, Yoshimura A, Yano Y, Hara Y
Journal of periodontal research 2014 Jun;49(3):314-22
Journal of periodontal research 2014 Jun;49(3):314-22
Gram-positive bacteria as an antigen topically applied into gingival sulcus of immunized rat accelerates periodontal destruction.
Nagano F, Kaneko T, Yoshinaga Y, Ukai T, Kuramoto A, Nakatsu S, Oshino K, Ichimura I, Hara Y
Journal of periodontal research 2013 Aug;48(4):420-7
Journal of periodontal research 2013 Aug;48(4):420-7
Topical application of lipopolysaccharide into gingival sulcus promotes periodontal destruction in rats immunized with lipopolysaccharide.
Yoshinaga Y, Ukai T, Kaneko T, Nakatsu S, Shiraishi C, Kuramoto A, Oshino K, Ichimura I, Hara Y
Journal of periodontal research 2012 Oct;47(5):674-80
Journal of periodontal research 2012 Oct;47(5):674-80
The formation of immune complexes is involved in the acute phase of periodontal destruction in rats.
Kuramoto A, Yoshinaga Y, Kaneko T, Ukai T, Shiraishi C, Oshino K, Ichimura I, Hara Y
Journal of periodontal research 2012 Aug;47(4):455-62
Journal of periodontal research 2012 Aug;47(4):455-62
Interaction of C1q with IgG1, C-reactive protein and pentraxin 3: mutational studies using recombinant globular head modules of human C1q A, B, and C chains.
Roumenina LT, Ruseva MM, Zlatarova A, Ghai R, Kolev M, Olova N, Gadjeva M, Agrawal A, Bottazzi B, Mantovani A, Reid KB, Kishore U, Kojouharova MS
Biochemistry 2006 Apr 4;45(13):4093-104
Biochemistry 2006 Apr 4;45(13):4093-104
No comments: Submit comment
No validations: Submit validation data