HPA017653

DNAJC14 antibody from Sigma-Aldrich
DNAJ, DRIP78, FLJ32792, HDJ3, LIP6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017653
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017653, RRID:AB_1847799
Product name
Anti-DNAJC14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017653
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily C member 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WGWLELPWVKQNINRQGNAPVASGRYCQPEEEVAR
LLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQ
LAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKR
KEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTM
MCSRCQG
Storage
-20C
Provider Type Product Number
- No reagents -