Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA017653 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA017653, RRID:AB_1847799
- Product name
- Anti-DNAJC14
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
WGWLELPWVKQNINRQGNAPVASGRYCQPEEEVAR
LLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQ
LAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKR
KEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTM
MCSRCQG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Flavivirus replication complex assembly revealed by DNAJC14 functional mapping.
Identification and characterization of the host protein DNAJC14 as a broadly active flavivirus replication modulator.
Yi Z, Yuan Z, Rice CM, MacDonald MR
Journal of virology 2012 Nov;86(21):11815-32
Journal of virology 2012 Nov;86(21):11815-32
Identification and characterization of the host protein DNAJC14 as a broadly active flavivirus replication modulator.
Yi Z, Sperzel L, Nürnberger C, Bredenbeek PJ, Lubick KJ, Best SM, Stoyanov CT, Law LM, Yuan Z, Rice CM, MacDonald MR
PLoS pathogens 2011 Jan 13;7(1):e1001255
PLoS pathogens 2011 Jan 13;7(1):e1001255
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows cytoplasmic positivity in glandular cells. Parietal cells show strong staining.
- Sample type
- HUMAN