Antibody data

Product number
H00051246-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051246-B01P, RRID:AB_1580415
Product name
SCOTIN purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00051246-B01P
Antibody type
Polyclonal
Antigen
SCOTIN (AAH01463, 1 a.a. ~ 137 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKT
CRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPS
YQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPA
YHETLAGGAAAPYPASQPPYNPAYMDAPKAAL
Vial size
50 µg
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -