HPA021324

PEG10 antibody from Atlas Antibodies
HB-1, KIAA1051, Mar2, Mart2, MEF3L, RGAG3, RTL2, SIRH1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021324
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021324, RRID:AB_1855181
Product name
Anti-PEG10
Provider product page
Atlas Antibodies - HPA021324
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SIPNLEDQAHLATYTEFVPQIPGYQTYPTYAAYPT
YPVGFAWYPVGRDGQGRSLYVPVMITWNPHWYRQP
PVPQYPPPQPPPPPPPPPPPPSYSTL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -