HPA021324

PEG10 antibody from Sigma-Aldrich
HB-1, KIAA1051, Mar2, Mart2, MEF3L, RGAG3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021324
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021324, RRID:AB_1855181
Product name
Anti-PEG10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021324
Antibody type
Polyclonal
Antigen
Retrotransposon-derived protein PEG10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SIPNLEDQAHLATYTEFVPQIPGYQTYPTYAAYPT
YPVGFAWYPVGRDGQGRSLYVPVMITWNPHWYRQP
PVPQYPPPQPPPPPPPPPPPPSYSTL
Storage
-20C
Provider Type Product Number
- No reagents -