HPA014133

PREB antibody from Sigma-Aldrich
SEC12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014133
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014133, RRID:AB_1855695
Product name
Anti-PREB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014133
Antibody type
Polyclonal
Antigen
Prolactin regulatory element-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKK
CGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCF
NHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEG
EIEDLALGPDGKLVTVGRDLKASVWQKDQLVTQLH
WQENGPT
Storage
-20C
Provider Type Product Number
- No reagents -