HPA031734

TAF8 antibody from MilliporeSigma / Merck KGaA
FLJ32821, TAF(II)43, TBN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031734
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031734, RRID:AB_10603994
Product name
Anti-TAF8 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031734
Antibody type
Polyclonal
Antigen
TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFES
AEKASVETLTEMLQSYISEIGRSAKSY
Storage
-20C
Provider Type Product Number
- No reagents -