HPA013547

CYP2C8 antibody from Sigma-Aldrich
CPC8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013547
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013547, RRID:AB_1847435
Product name
Anti-CYP2C8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013547
Antibody type
Polyclonal
Antigen
Cytochrome P450 2C8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRICAGEGLARMELFLFLTTILQNFNLKSVDDLKN
LNTTAVTKGIVSLPPSYQICFIPV
Storage
-20C
Provider Type Product Number
- No reagents -