HPA013547

CYP2C8 antibody from Atlas Antibodies
CPC8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013547
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013547, RRID:AB_1847435
Product name
Anti-CYP2C8
Provider product page
Atlas Antibodies - HPA013547
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KRICAGEGLARMELFLFLTTILQNFNLKSVDDLKN
LNTTAVTKGIVSLPPSYQICFIPV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -