HPA013547

antibody from Atlas Antibodies

Targeting: CYP2C8 CPC8

Antibody data

Submit

Validation data

Product number: HPA013547 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA013547, RRID:AB_1847435
Product name: Anti-CYP2C8
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KRICAGEGLARMELFLFLTTILQNFNLKSVDDLKN LNTTAVTKGIVSLPPSYQICFIPV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CYP2C8 protein structure - HPA013547 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and skin tissues using HPA013547 antibody. Corresponding CYP2C8 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebellum, fallopian tube, liver and skin using Anti-CYP2C8 antibody HPA013547 (A) shows similar protein distribution across tissues to independent antibody HPA013970 (B).
Antibody #2 product nr: HPA013970
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows no positivity in squamous epithelial cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows no positivity in Purkinje cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human Fallopian tube shows no positivity in glandular cells as expected.
Sample type: HUMAN