ABIN631244

antibody from antibodies-online

Targeting: GUCA1A C6orf131, COD3, CORD14, dJ139D8.6, GCAP, GCAP1, GUCA, GUCA1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN631244 - Provider product page
Provider: antibodies-online
Product name: anti-Guanylate Cyclase Activator 1A (Retina) (GUCA1A) antibody
Antibody type: Polyclonal
Antigen: GUCA1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

GUCA1A protein structure - ABIN631244 shown in red.