HPA018014

SCARB2 antibody from Sigma-Aldrich
CD36L2, HLGP85, LIMP-2, LIMPII, SR-BII
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018014
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018014, RRID:AB_1852881
Product name
Anti-SCARB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018014
Antibody type
Polyclonal
Antigen
Lysosome membrane protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQG
LPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVL
NVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPN
QEDHETFVDINPLTGIILKAAKRFQINIYVKKLDD
FVETGD
Storage
-20C
Provider Type Product Number
- No reagents -