HPA018014

SCARB2 antibody from Atlas Antibodies
CD36L2, HLGP85, LIMP-2, LIMPII, SR-BII
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018014
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018014, RRID:AB_1852881
Product name
Anti-SCARB2
Provider product page
Atlas Antibodies - HPA018014
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQG
LPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVL
NVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPN
QEDHETFVDINPLTGIILKAAKRFQINIYVKKLDD
FVETGD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -