HPA031453

GUCA1B antibody from MilliporeSigma / Merck KGaA
GCAP2, RP48
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031453
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031453, RRID:AB_10602602
Product name
Anti-GUCA1B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031453
Antibody type
Polyclonal
Antigen
guanylate cyclase activator 1B (retina) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENG
DGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQ
QRRK
Storage
-20C
Provider Type Product Number
- No reagents -