Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003034-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003034-M04, RRID:AB_566289
- Product name
- HAL monoclonal antibody (M04), clone 4F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HAL.
- Antigen sequence
LAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIK
DRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEH
IPESRPLSPTAFSLQFLHKKSTKIPESEDL- Isotype
- IgG
- Antibody clone number
- 4F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Increased sensitivity of histidinemic mice to UVB radiation suggests a crucial role of endogenous urocanic acid in photoprotection.
Histidase expression in human epidermal keratinocytes: regulation by differentiation status and all-trans retinoic acid.
Barresi C, Stremnitzer C, Mlitz V, Kezic S, Kammeyer A, Ghannadan M, Posa-Markaryan K, Selden C, Tschachler E, Eckhart L
The Journal of investigative dermatology 2011 Jan;131(1):188-94
The Journal of investigative dermatology 2011 Jan;131(1):188-94
Histidase expression in human epidermal keratinocytes: regulation by differentiation status and all-trans retinoic acid.
Eckhart L, Schmidt M, Mildner M, Mlitz V, Abtin A, Ballaun C, Fischer H, Mrass P, Tschachler E
Journal of dermatological science 2008 Jun;50(3):209-15
Journal of dermatological science 2008 Jun;50(3):209-15
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HAL expression in transfected 293T cell line by HAL monoclonal antibody (M04), clone 4F2.Lane 1: HAL transfected lysate(72.698 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of HAL transfected lysate using anti-HAL monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HAL MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol