ABIN405756

HAL antibody from antibodies-online
HIS
Western blot
Data presented on provider website
Immunohistochemistry
Recommended by provider

Antibody data

Product number
ABIN405756
Provider
antibodies-online
Product name
anti-Histidine Ammonia-Lyase (HAL) (N-Term) antibody
Provider product page
antibodies-online - ABIN405756
Antibody type
Polyclonal
Antigen
The immunogen for anti-HAL antibody: synthetic peptide directed towards the N terminal of human HAL
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALR
INVLA KGYSGISLET
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -