HPA016858

ESYT1 antibody from Sigma-Aldrich
FAM62A, KIAA0747, MBC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016858
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016858, RRID:AB_1848404
Product name
Anti-FAM62A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016858
Antibody type
Polyclonal
Antigen
Extended-synaptotagmin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEW
LTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNS
LIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLS
PYATLTVGDSSHKTKTISQTSAPVWDESASFLIRK
PHTE
Storage
-20C
Provider Type Product Number
- No reagents -