HPA016858

ESYT1 antibody from Atlas Antibodies
FAM62A, KIAA0747, MBC2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA016858
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016858, RRID:AB_1848404
Product name
Anti-ESYT1
Provider product page
Atlas Antibodies - HPA016858
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEW
LTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNS
LIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLS
PYATLTVGDSSHKTKTISQTSAPVWDESASFLIRK
PHTE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -