HPA018015

IFNAR1 antibody from Sigma-Aldrich
IFNAR, IFRC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018015
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018015, RRID:AB_1851433
Product name
Anti-IFNAR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018015
Antibody type
Polyclonal
Antigen
Interferon-alpha/beta receptor alpha chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQAS
DGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDS
FHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNA
ERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKL
N
Storage
-20C
Provider Type Product Number
- No reagents -