Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009060-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009060-M07, RRID:AB_530162
- Product name
- PAPSS2 monoclonal antibody (M07), clone 2A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PAPSS2.
- Antigen sequence
DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEI
IPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMR
KLAREGENPPDGFMAPKAWKVLTDYYRSLE- Isotype
- IgG
- Antibody clone number
- 2A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references PAPSS2 promotes alkaline phosphates activity and mineralization of osteoblastic MC3T3-E1 cells by crosstalk and Smads signal pathways.
Wang W, Li F, Wang K, Cheng B, Guo X
PloS one 2012;7(8):e43475
PloS one 2012;7(8):e43475
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PAPSS2 monoclonal antibody (M07), clone 2A8 Western Blot analysis of PAPSS2 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PAPSS2 expression in transfected 293T cell line by PAPSS2 monoclonal antibody (M07), clone 2A8.Lane 1: PAPSS2 transfected lysate(69.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PAPSS2 monoclonal antibody (M07), clone 2A8. Western Blot analysis of PAPSS2 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PAPSS2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PAPSS2 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PAPSS2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol