H00023304-M01
antibody from Abnova Corporation
Targeting: UBR2
bA49A4.1, C6orf133, dJ392M17.3, KIAA0349
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023304-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023304-M01, RRID:AB_509099
- Product name
- UBR2 monoclonal antibody (M01), clone 4G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UBR2.
- Antigen sequence
MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLT
REVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLL
GPMEWYLCGEDPAFGFPKLEQANKPSHLCG- Isotype
- IgG
- Antibody clone number
- 4G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of UBR2 expression in transfected 293T cell line by UBR2 monoclonal antibody (M01), clone 4G4.Lane 1: UBR2 transfected lysate(50 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UBR2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to UBR2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol