HPA001534

BBS1 antibody from Sigma-Aldrich
FLJ23590
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001534
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001534, RRID:AB_2178972
Product name
Anti-RBMY1A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001534
Antibody type
Polyclonal
Antigen
RNA-binding motif protein, Y chromosome, family 1 member A1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPIS
EVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNG
KSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSP
SGSLRSARGSRGGTRGW
Storage
-20C
Provider Type Product Number
- No reagents -