Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009378-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009378-A01, RRID:AB_463061
- Product name
- NRXN1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant NRXN1.
- Antigen sequence
LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARG
LVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEP
ATLLADTPVNDGAWHSVRIRRQFRNTTLFI- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Differentially expressed gene profile in the 6-hydroxy-dopamine-induced cell culture model of Parkinson's disease.
Cdk5 promotes synaptogenesis by regulating the subcellular distribution of the MAGUK family member CASK.
Noelker C, Schwake M, Balzer-Geldsetzer M, Bacher M, Popp J, Schlegel J, Eggert K, Oertel WH, Klockgether T, Dodel RC
Neuroscience letters 2012 Jan 17;507(1):10-5
Neuroscience letters 2012 Jan 17;507(1):10-5
Cdk5 promotes synaptogenesis by regulating the subcellular distribution of the MAGUK family member CASK.
Samuels BA, Hsueh YP, Shu T, Liang H, Tseng HC, Hong CJ, Su SC, Volker J, Neve RL, Yue DT, Tsai LH
Neuron 2007 Dec 6;56(5):823-37
Neuron 2007 Dec 6;56(5):823-37
No comments: Submit comment
No validations: Submit validation data