HPA014205

LNPK antibody from MilliporeSigma / Merck KGaA
KIAA1715, LNP, LNP1, Ul
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014205
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014205, RRID:AB_2234186
Product name
Anti-KIAA1715 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014205
Antibody type
Polyclonal
Antigen
Protein lunapark recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GALDRIVEYLVGDGPQNRYALICQQCFSHNGMALK
EEFEYIAFRCAYCFFLNPARKTRPQAPRLPEFSFE
KRQVVEGSSSVGPLPSGSVLSSDNQFNEESLEHDV
LDDNTEQTDDKIPATEQ
Storage
-20C
Provider Type Product Number
- No reagents -