H00054957-B01P

TXNL4B antibody from Abnova Corporation
Dim2, DLP, FLJ20511

Antibody data

Product number
H00054957-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054957-B01P, RRID:AB_1139075
Product name
TXNL4B purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00054957-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TXNL4B protein.
Antigen sequence
MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDED
PVCLQLDDILSKTSSDLSKMAATYLVDVDQTAVYT
QYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGS
FKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIP
KYDRLYQDI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -