Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARP35763_P050 - Provider product page

- Provider
- Aviva Systems Biology
- Proper citation
- Aviva Systems Biology Cat#ARP35763_P050, RRID:AB_10879821
- Product name
- Dlx6 antibody - C-terminal region (ARP35763_P050)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- This is a rabbit polyclonal antibody against Dlx6. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
- Reactivity
- Human, Rat
- Host
- Rabbit
- Antigen sequence
FQQTQYLALPERAELAASLGLTQTQVKIWFQNKRS
KFKKLLKQGSNPHES- Vial size
- 50 µg
- Concentration
- 1 mg/ml
- Handling
- Add 50 µl of distilled water. Final anti-Dlx6 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Submitted references Expression and function of Dlx genes in the osteoblast lineage.
Li H, Marijanovic I, Kronenberg MS, Erceg I, Stover ML, Velonis D, Mina M, Heinrich JG, Harris SE, Upholt WB, Kalajzic I, Lichtler AC
Developmental biology 2008 Apr 15;316(2):458-70
Developmental biology 2008 Apr 15;316(2):458-70
No comments: Submit comment
Supportive validation
- Submitted by
- Aviva Systems Biology (provider)
- Main image

- Experimental details
- WB Suggested Anti-Dlx6 AntibodyTitration: 1.0µg/ml. Positive Control: Rat Muscle