Antibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00121441-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00121441-M05, RRID:AB_534956
- Product name
- NEDD1 monoclonal antibody (M05), clone 7D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NEDD1.
- Antigen sequence
AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNM
IQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMH
SLLERYSVNEGLVAEIERLREENKRLRAHF- Isotype
- IgG
- Antibody clone number
- 7D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Augmin shapes the anaphase spindle for efficient cytokinetic furrow ingression and abscission.
The dynamics of microtubule minus ends in the human mitotic spindle.
SPICE--a previously uncharacterized protein required for centriole duplication and mitotic chromosome congression.
Functional central spindle assembly requires de novo microtubule generation in the interchromosomal region during anaphase.
Axon extension occurs independently of centrosomal microtubule nucleation.
Plk1-dependent recruitment of gamma-tubulin complexes to mitotic centrosomes involves multiple PCM components.
FAM29A, a target of Plk1 regulation, controls the partitioning of NEDD1 between the mitotic spindle and the centrosomes.
FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle.
Uehara R, Kamasaki T, Hiruma S, Poser I, Yoda K, Yajima J, Gerlich DW, Goshima G
Molecular biology of the cell 2016 Mar 1;27(5):812-27
Molecular biology of the cell 2016 Mar 1;27(5):812-27
The dynamics of microtubule minus ends in the human mitotic spindle.
Lecland N, Lüders J
Nature cell biology 2014 Aug;16(8):770-8
Nature cell biology 2014 Aug;16(8):770-8
SPICE--a previously uncharacterized protein required for centriole duplication and mitotic chromosome congression.
Archinti M, Lacasa C, Teixidó-Travesa N, Lüders J
Journal of cell science 2010 Sep 15;123(Pt 18):3039-46
Journal of cell science 2010 Sep 15;123(Pt 18):3039-46
Functional central spindle assembly requires de novo microtubule generation in the interchromosomal region during anaphase.
Uehara R, Goshima G
The Journal of cell biology 2010 Oct 18;191(2):259-67
The Journal of cell biology 2010 Oct 18;191(2):259-67
Axon extension occurs independently of centrosomal microtubule nucleation.
Stiess M, Maghelli N, Kapitein LC, Gomis-Rüth S, Wilsch-Bräuninger M, Hoogenraad CC, Tolić-Nørrelykke IM, Bradke F
Science (New York, N.Y.) 2010 Feb 5;327(5966):704-7
Science (New York, N.Y.) 2010 Feb 5;327(5966):704-7
Plk1-dependent recruitment of gamma-tubulin complexes to mitotic centrosomes involves multiple PCM components.
Haren L, Stearns T, Lüders J
PloS one 2009 Jun 19;4(6):e5976
PloS one 2009 Jun 19;4(6):e5976
FAM29A, a target of Plk1 regulation, controls the partitioning of NEDD1 between the mitotic spindle and the centrosomes.
Zhu H, Fang K, Fang G
Journal of cell science 2009 Aug 1;122(Pt 15):2750-9
Journal of cell science 2009 Aug 1;122(Pt 15):2750-9
FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle.
Zhu H, Coppinger JA, Jang CY, Yates JR 3rd, Fang G
The Journal of cell biology 2008 Dec 1;183(5):835-48
The Journal of cell biology 2008 Dec 1;183(5):835-48
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NEDD1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to NEDD1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.75 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol