HPA003044

TST antibody from Sigma-Aldrich
RDS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003044
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003044, RRID:AB_1858417
Product name
Anti-TST antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003044
Antibody type
Polyclonal
Antigen
Thiosulfate sulfurtransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEP
EPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKGPEE
LRALFQTKKVDLSQPLIATCRKGVTACHVALAAYL
CGKPDVAVYDGSWSEWFRRAPPESRVSQGKS
Storage
-20C
Provider Type Product Number
- No reagents -