HPA003643

TST antibody from Sigma-Aldrich
RDS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003643
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003643, RRID:AB_1080411
Product name
Anti-TST antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003643
Antibody type
Polyclonal
Antigen
Thiosulfate sulfurtransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASW
YSPGTREARKEYLERHVPGASFFDIEECRDTASPY
EMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGS
FYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPV
TSEPS
Storage
-20C
Provider Type Product Number
- No reagents -