Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405545 - Provider product page 
- Provider
- antibodies-online
- Product name
- anti-Membrane-Associated Ring Finger (C3HC4) 4, E3 Ubiquitin Protein Ligase (MARCH4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MARCH4 antibody: synthetic peptide directed towards the N terminal of human MARCH4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
- GLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQP
 PGLAA NNTLPALGAG
- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references		Downregulation of major histocompatibility complex class I by human ubiquitin ligases related to viral immune evasion proteins.
				
		
	
			Bartee E, Mansouri M, Hovey Nerenberg BT, Gouveia K, Früh K
Journal of virology 2004 Feb;78(3):1109-20
		Journal of virology 2004 Feb;78(3):1109-20
				No comments: Submit comment	
	
			
			No validations: Submit validation data