HPA014348

MARCHF4 antibody from Sigma-Aldrich
KIAA1399, MARCH-IV, MARCH4, RNF174
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014348
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014348, RRID:AB_1853578
Product name
Anti-MARCH4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014348
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase MARCH4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPS
SEEETAGTPAPEQGPAQAAGHPSGPLSHHHCAYTI
LHILSHLRPHEQRSP
Storage
-20C
Provider Type Product Number
- No reagents -