HPA014348

MARCHF4 antibody from Atlas Antibodies
KIAA1399, MARCH-IV, MARCH4, RNF174
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014348
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014348, RRID:AB_1853578
Product name
Anti-MARCH4
Provider product page
Atlas Antibodies - HPA014348
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPS
SEEETAGTPAPEQGPAQAAGHPSGPLSHHHCAYTI
LHILSHLRPHEQRSP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -