SAB2101433

MARCHF4 antibody from MilliporeSigma / Merck KGaA
KIAA1399, MARCH-IV, MARCH4, RNF174
No application information provided.

Antibody data

Product number
SAB2101433
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2101433, RRID:AB_10605523
Product name
Anti-MARCH4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2101433
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_065865.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQP
PGLAANNTLPALGAG
Storage
-20C
Provider Type Product Number
- No reagents -