Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000059-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000059-M02, RRID:AB_605898
- Product name
- ACTA2 monoclonal antibody (M02), clone 4A8-2H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ACTA2.
- Antigen sequence
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPS
IVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK
YPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPT
LLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA
VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPH
AIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI
VRDIKEKLCYVALDFENEMATAASSSSLEKSYELP
DGQVITIGNERFRCPETLFQPSFIGMESAGIHETT
YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRM
QKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS
LSTFQQMWISKQEYDEAGPSIVHRKCF- Isotype
- IgG
- Antibody clone number
- 4A8-2H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references miR-199a-5p Is upregulated during fibrogenic response to tissue injury and mediates TGFbeta-induced lung fibroblast activation by targeting caveolin-1.
Isolation and characterization of a primary proximal tubular epithelial cell model from human kidney by CD10/CD13 double labeling.
Lino Cardenas CL, Henaoui IS, Courcot E, Roderburg C, Cauffiez C, Aubert S, Copin MC, Wallaert B, Glowacki F, Dewaeles E, Milosevic J, Maurizio J, Tedrow J, Marcet B, Lo-Guidice JM, Kaminski N, Barbry P, Luedde T, Perrais M, Mari B, Pottier N
PLoS genetics 2013;9(2):e1003291
PLoS genetics 2013;9(2):e1003291
Isolation and characterization of a primary proximal tubular epithelial cell model from human kidney by CD10/CD13 double labeling.
Van der Hauwaert C, Savary G, Gnemmi V, Glowacki F, Pottier N, Bouillez A, Maboudou P, Zini L, Leroy X, Cauffiez C, Perrais M, Aubert S
PloS one 2013;8(6):e66750
PloS one 2013;8(6):e66750
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ACTA2 monoclonal antibody (M01), clone 4A8-2H3. Western Blot analysis of ACTA2 expression in human omentum, serous carcinoma.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ACTA2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ACTA2 on HeLa cell. [antibody concentration 1 ~ 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol