Antibody data

Product number
H00005528-M21
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005528-M21, RRID:AB_1579039
Product name
PPP2R5D monoclonal antibody (M21), clone 1A3
Provider product page
Abnova Corporation - H00005528-M21
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PPP2R5D.
Antigen sequence
RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLK
RTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIK
ALEAHKRAEEFLTASQEAL
Isotype
IgG
Antibody clone number
1A3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -