Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005528-M21 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005528-M21, RRID:AB_1579039
- Product name
- PPP2R5D monoclonal antibody (M21), clone 1A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PPP2R5D.
- Antigen sequence
RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLK
RTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIK
ALEAHKRAEEFLTASQEAL- Isotype
- IgG
- Antibody clone number
- 1A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PPP2R5D monoclonal antibody (M21), clone 1A3. Western Blot analysis of PPP2R5D expression in Jurkat(Cat # L017V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PPP2R5D is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PPP2R5D on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol