HPA029045

PPP2R5D antibody from MilliporeSigma / Merck KGaA
B56D, B56delta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029045
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029045, RRID:AB_10598912
Product name
Anti-PPP2R5D antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029045
Antibody type
Polyclonal
Antigen
protein phosphatase 2, regulatory subunit B', delta isoform recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNP
QYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVE
TEAVQMLKDIKKEKVLLRRKSELPQDVY
Storage
-20C
Provider Type Product Number
- No reagents -